missing translation for 'onlineSavingsMsg'
Learn More
Learn More
USP22 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-82941-25ul
This item is not returnable.
View return policy
Description
USP22 Polyclonal specifically detects USP22 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Specifications
| USP22 | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 0.25-2 ug/mL | |
| Q9UPT9 | |
| USP22 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:MVSRPEPEGEAMDAELAVAPPGCSHLGSFKVDNWKQNLRAIYQCF | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| Deubiquitinating enzyme 22, EC 3.1.2.15, EC 3.4.19.12, KIAA1063ubiquitin carboxyl-terminal hydrolase 22, KIAA1064, ubiquitin specific peptidase 22, ubiquitin specific peptidase 3-like, ubiquitin specific protease 22, ubiquitin thioesterase 22, Ubiquitin thiolesterase 22, ubiquitin-specific processing protease 22, Ubiquitin-specific-processing protease 22, USP3L | |
| Rabbit | |
| 60 kDa | |
| 25 μL | |
| Cancer, Cell Cycle and Replication, Signal Transduction, Stem Cell Markers | |
| 23326 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction