missing translation for 'onlineSavingsMsg'
Learn More
Learn More
USP14 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£145.00 - £417.00
Specifications
| Antigen | USP14 |
|---|---|
| Dilution | Western Blot 1:500 - 1:2000, ELISA |
| Applications | ELISA, Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
30227306
|
Novus Biologicals
NBP3-35687-20ul |
20 μL |
£145.00
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
30229565
|
Novus Biologicals
NBP3-35687-100ul |
100 μL |
£417.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
USP14 Polyclonal antibody specifically detects USP14 in Human,Mouse samples. It is validated for ELISA,Western BlotSpecifications
| USP14 | |
| ELISA, Western Blot | |
| Unconjugated | |
| Rabbit | |
| Protein Turnover, Ubiquitin Proteasome Pathway | |
| PBS (pH 7.3), 50% glycerol | |
| 9097 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500 - 1:2000, ELISA | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse | |
| Deubiquitinating enzyme 14, EC 3.1.2.15, EC 3.4.19.12, TGT, TGTubiquitin carboxyl-terminal hydrolase 14, tRNA-guanine transglycosylase, 60-kD subunit, ubiquitin specific peptidase 14 (tRNA-guanine transglycosylase), ubiquitin specific protease 14 (tRNA-guanine transglycosylase), ubiquitin thioesterase 14, Ubiquitin thiolesterase 14, ubiquitin-specific processing protease 14, Ubiquitin-specific-processing protease 14 | |
| A synthetic peptide corresponding to a sequence within amino acids 400-500 of human USP14 (NP_005142.1).,, Sequence:, KYEPFSFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYVSWVKRKQDEWIKFDDDKVSIVTPEDILRLSGGGDWHIAYVLLYGPRRVEIMEEESEQ | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title