USP14 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-35687-100ul

Product Code. 30229565

Description

USP14 Polyclonal antibody specifically detects USP14 in Human,Mouse samples. It is validated for ELISA,Western Blot

Specifications

• Antigen: USP14
• Classification: Polyclonal
• Dilution: Western Blot 1:500 - 1:2000, ELISA
• Gene Alias: Deubiquitinating enzyme 14, EC 3.1.2.15, EC 3.4.19.12, TGT, TGTubiquitin carboxyl-terminal hydrolase 14, tRNA-guanine transglycosylase, 60-kD subunit, ubiquitin specific peptidase 14 (tRNA-guanine transglycosylase), ubiquitin specific protease 14 (tRNA-guanine transglycosylase), ubiquitin thioesterase 14, Ubiquitin thiolesterase 14, ubiquitin-specific processing protease 14, Ubiquitin-specific-processing protease 14
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 400-500 of human USP14 (NP_005142.1).,, Sequence:, KYEPFSFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYVSWVKRKQDEWIKFDDDKVSIVTPEDILRLSGGGDWHIAYVLLYGPRRVEIMEEESEQ
• Quantity: 100 μL
• Research Discipline: Protein Turnover, Ubiquitin Proteasome Pathway
• Gene ID (Entrez): 9097
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.3), 50% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Mouse
• Form: Purified