missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Urotensin-2 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
£149.00 - £366.00
Specifications
| Antigen | Urotensin-2 |
|---|---|
| Dilution | Western Blot 1:500-1:2000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18654872
|
Novus Biologicals
NBP2-94140-0.02ml |
0.02 mL |
£149.00
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18694942
|
Novus Biologicals
NBP2-94140-0.1ml |
0.1 mL |
£366.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Urotensin-2 Polyclonal antibody specifically detects Urotensin-2 in Human, Mouse samples. It is validated for Western BlotSpecifications
| Urotensin-2 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Cardiovascular Biology, Cell Biology, Signal Transduction | |
| PBS (pH 7.3), 50% glycerol | |
| 10911 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500-1:2000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse | |
| UCN2, UIIPRO1068, U-IIUrotensin II, urotensin 2, urotensin-2 | |
| A synthetic peptide corresponding to a sequence within amino acids 35-124 of human Urotensin-2 (NP_006777.1). APHEDARLTPEELERASLLQILPEMLGAERGDILRKADSSTNIFNPRGNLRKFQDFSGQDPNILLSHLLARIWKPYKKRETPDCFWKYCV | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title