missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Urotensin-2 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-94140-0.02ml
This item is not returnable.
View return policy
Description
Urotensin-2 Polyclonal antibody specifically detects Urotensin-2 in Human, Mouse samples. It is validated for Western Blot
Specifications
| Urotensin-2 | |
| Polyclonal | |
| Western Blot 1:500-1:2000 | |
| UCN2, UIIPRO1068, U-IIUrotensin II, urotensin 2, urotensin-2 | |
| A synthetic peptide corresponding to a sequence within amino acids 35-124 of human Urotensin-2 (NP_006777.1). APHEDARLTPEELERASLLQILPEMLGAERGDILRKADSSTNIFNPRGNLRKFQDFSGQDPNILLSHLLARIWKPYKKRETPDCFWKYCV | |
| 0.02 mL | |
| Cardiovascular Biology, Cell Biology, Signal Transduction | |
| 10911 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction