missing translation for 'onlineSavingsMsg'
Learn More
Learn More
UPF3B Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | UPF3B |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
UPF3B Polyclonal specifically detects UPF3B in Human samples. It is validated for Western Blot.Specifications
| UPF3B | |
| Polyclonal | |
| Rabbit | |
| Q9BZI7 | |
| 65109 | |
| Synthetic peptides corresponding to UPF3B(UPF3 regulator of nonsense transcripts homolog B (yeast)) The peptide sequence was selected from the middle region of UPF3B (NP_542199) Peptide sequence KIDRIPERDKLKDEPKIKVHRFLLQAVNQKNLLKKPEKGDEKELDKREKA. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| HUPF3B, Nonsense mRNA reducing factor 3B, regulator of nonsense transcripts 3B, RENT3BhUpf3p-X, UPF3 regulator of nonsense transcripts homolog B (yeast), UPF3XMRXS14, Up-frameshift suppressor 3 homolog B, Up-frameshift suppressor 3 homolog on chromosome X | |
| UPF3B | |
| IgG | |
| 58 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title