UPF3B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-57233

Product Code. 18243513

Description

UPF3B Polyclonal specifically detects UPF3B in Human samples. It is validated for Western Blot.

Specifications

• Antigen: UPF3B
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: HUPF3B, Nonsense mRNA reducing factor 3B, regulator of nonsense transcripts 3B, RENT3BhUpf3p-X, UPF3 regulator of nonsense transcripts homolog B (yeast), UPF3XMRXS14, Up-frameshift suppressor 3 homolog B, Up-frameshift suppressor 3 homolog on chromosome X
• Host Species: Rabbit
• Molecular Weight of Antigen: 58 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Canine: 100%; Mouse: 92%; Rat: 92%.
• Target Species: Human, Mouse, Rat, Pig, Canine, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9BZI7
• Gene Symbols: UPF3B
• Immunogen: Synthetic peptides corresponding to UPF3B(UPF3 regulator of nonsense transcripts homolog B (yeast)) The peptide sequence was selected from the middle region of UPF3B (NP_542199) Peptide sequence KIDRIPERDKLKDEPKIKVHRFLLQAVNQKNLLKKPEKGDEKELDKREKA.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 65109
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.