missing translation for 'onlineSavingsMsg'
Learn More
Learn More
UNC84B Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | UNC84B |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
UNC84B Polyclonal specifically detects UNC84B in Human samples. It is validated for Western Blot.Specifications
| UNC84B | |
| Polyclonal | |
| Rabbit | |
| Q9UH99 | |
| 25777 | |
| Synthetic peptides corresponding to UNC84B(unc-84 homolog B (C. elegans)) The peptide sequence was selected from the N terminal of UNC84B. Peptide sequence SRRPDEGWEARDSSPHFQAEQRVMSRVHSLERRLEALAAEFSSNWQKEAM. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| FRIGG, KIAA0668, MGC133055, MGC133056, nuclear envelope protein, Protein unc-84 homolog B, Rab5-interacting protein, rab5IP, Sad1 and UNC84 domain containing 2, Sad1 unc-84 domain protein 2, Sad1/unc-84 protein-like 2, SUN domain-containing protein 2, unc-84 homolog B, unc-84 homolog B (C. elegans), UNC84B | |
| SUN2 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title