UNC84B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-58289

Product Code. 18281515

Description

UNC84B Polyclonal specifically detects UNC84B in Human samples. It is validated for Western Blot.

Specifications

• Antigen: UNC84B
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: FRIGG, KIAA0668, MGC133055, MGC133056, nuclear envelope protein, Protein unc-84 homolog B, Rab5-interacting protein, rab5IP, Sad1 and UNC84 domain containing 2, Sad1 unc-84 domain protein 2, Sad1/unc-84 protein-like 2, SUN domain-containing protein 2, unc-84 homolog B, unc-84 homolog B (C. elegans), UNC84B
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 25777
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9UH99
• Gene Symbols: SUN2
• Immunogen: Synthetic peptides corresponding to UNC84B(unc-84 homolog B (C. elegans)) The peptide sequence was selected from the N terminal of UNC84B. Peptide sequence SRRPDEGWEARDSSPHFQAEQRVMSRVHSLERRLEALAAEFSSNWQKEAM.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Rat: 100%; Human: 100%; Bovine: 92%; Canine: 92%; Mouse: 92%;.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG