missing translation for 'onlineSavingsMsg'
Learn More
Learn More
UNC84B Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-58289
This item is not returnable.
View return policy
Description
UNC84B Polyclonal specifically detects UNC84B in Human samples. It is validated for Western Blot.
Specifications
| UNC84B | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| FRIGG, KIAA0668, MGC133055, MGC133056, nuclear envelope protein, Protein unc-84 homolog B, Rab5-interacting protein, rab5IP, Sad1 and UNC84 domain containing 2, Sad1 unc-84 domain protein 2, Sad1/unc-84 protein-like 2, SUN domain-containing protein 2, unc-84 homolog B, unc-84 homolog B (C. elegans), UNC84B | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 25777 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| Q9UH99 | |
| SUN2 | |
| Synthetic peptides corresponding to UNC84B(unc-84 homolog B (C. elegans)) The peptide sequence was selected from the N terminal of UNC84B. Peptide sequence SRRPDEGWEARDSSPHFQAEQRVMSRVHSLERRLEALAAEFSSNWQKEAM. | |
| 100 μL | |
| Primary | |
| Expected identity based on immunogen sequence: Rat: 100%; Human: 100%; Bovine: 92%; Canine: 92%; Mouse: 92%;. | |
| Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction