missing translation for 'onlineSavingsMsg'
Learn More
Learn More
UNC5H2/UNC5B Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
£260.00 - £587.00
Specifications
| Antigen | UNC5H2/UNC5B |
|---|---|
| Dilution | Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18324785
|
Novus Biologicals
NBP3-17778-25UL |
25 μg |
£260.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18337964
|
Novus Biologicals
NBP3-17778-100UL |
100 μg |
£587.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
UNC5H2/UNC5B Polyclonal antibody specifically detects UNC5H2/UNC5B in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| UNC5H2/UNC5B | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Apoptosis | |
| PBS, pH 7.2, 40% glycerol | |
| 219699 | |
| IgG | |
| Affinity purified |
| Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| p53RDL1, p53-regulated receptor for death and life protein 1, Protein unc-5 homolog 2, Protein unc-5 homolog B, transmembrane receptor Unc5H2, unc5 (C.elegans homolog) b, unc-5 homolog 2, unc-5 homolog B (C. elegans), UNC5H2netrin receptor UNC5B | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: SASLGSQQLLGLPRDPGSSVSGTFGCLGGRLSIPGTGVSLLVPNGAIPQGKFYEMYLLINKAESTLPLSE | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title