UNC5H2/UNC5B Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-17778-100UL

Product Code. 18337964

Description

UNC5H2/UNC5B Polyclonal antibody specifically detects UNC5H2/UNC5B in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: UNC5H2/UNC5B
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: p53RDL1, p53-regulated receptor for death and life protein 1, Protein unc-5 homolog 2, Protein unc-5 homolog B, transmembrane receptor Unc5H2, unc5 (C.elegans homolog) b, unc-5 homolog 2, unc-5 homolog B (C. elegans), UNC5H2netrin receptor UNC5B
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SASLGSQQLLGLPRDPGSSVSGTFGCLGGRLSIPGTGVSLLVPNGAIPQGKFYEMYLLINKAESTLPLSE
• Quantity: 100 μg
• Research Discipline: Apoptosis
• Gene ID (Entrez): 219699
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, 40% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified