missing translation for 'onlineSavingsMsg'
Learn More
Learn More
UNC50 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | UNC50 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
UNC50 Polyclonal specifically detects UNC50 in Human samples. It is validated for Western Blot.Specifications
| UNC50 | |
| Polyclonal | |
| Rabbit | |
| Q53HI1 | |
| 25972 | |
| Synthetic peptides corresponding to UNC50(unc-50 homolog (C. elegans)) The peptide sequence was selected from the N terminal of UNC50. Peptide sequence LPSTSVNSLVQGNGVLNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAW. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| geal-6 membrane-associated high-copy suppressor 1, GMH1, hGMH1, PDLs22, Periodontal ligament-specific protein 22, Protein GMH1 homolog, protein unc-50 homolog, unc-50 homolog (C. elegans), unc-50 related, UNCLDKFZp564G0222, Uncoordinated-like protein, URP | |
| UNC50 | |
| IgG | |
| 30 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title