UNC50 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-59665

Product Code. 18283473

Description

UNC50 Polyclonal specifically detects UNC50 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: UNC50
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: geal-6 membrane-associated high-copy suppressor 1, GMH1, hGMH1, PDLs22, Periodontal ligament-specific protein 22, Protein GMH1 homolog, protein unc-50 homolog, unc-50 homolog (C. elegans), unc-50 related, UNCLDKFZp564G0222, Uncoordinated-like protein, URP
• Host Species: Rabbit
• Molecular Weight of Antigen: 30 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q53HI1
• Gene Symbols: UNC50
• Immunogen: Synthetic peptides corresponding to UNC50(unc-50 homolog (C. elegans)) The peptide sequence was selected from the N terminal of UNC50. Peptide sequence LPSTSVNSLVQGNGVLNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAW.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 25972
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG