missing translation for 'onlineSavingsMsg'
Learn More
Learn More
UBR5/EDD Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£292.00 - £488.00
Specifications
| Antigen | UBR5/EDD |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18255505
|
Novus Biologicals
NBP2-58579 |
100 μL |
£488.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18626088
|
Novus Biologicals
NBP2-58579-25ul |
25 μL |
£292.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
UBR5/EDD Polyclonal specifically detects UBR5/EDD in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| UBR5/EDD | |
| Polyclonal | |
| Rabbit | |
| DNA Repair | |
| DD5, E3 ubiquitin protein ligase, HECT domain containing, 1, E3 ubiquitin-protein ligase, HECT domain-containing 1, EC 6.3.2, EC 6.3.2.-, EDD1E3 ubiquitin-protein ligase UBR5, EDDE3 identified by differential display, hHYD, HYDFLJ11310, Hyperplastic discs protein homolog, KIAA0896MGC57263, progestin induced protein, Progestin-induced protein, ubiquitin protein ligase E3 component n-recognin 5, ubiquitin-protein ligase | |
| UBR5 | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| 51366 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GSTSKEGEPNLDKKNTPVQSPVSLGEDLQWWPDKDGTKFICIGALYSELLAVSSKGELYQWKWSESEPYRNAQNPSLHHPRATFLGLTNEKI | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title