UBR5/EDD Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-58579-25ul

Product Code. 18626088

Description

UBR5/EDD Polyclonal specifically detects UBR5/EDD in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: UBR5/EDD
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: DD5, E3 ubiquitin protein ligase, HECT domain containing, 1, E3 ubiquitin-protein ligase, HECT domain-containing 1, EC 6.3.2, EC 6.3.2.-, EDD1E3 ubiquitin-protein ligase UBR5, EDDE3 identified by differential display, hHYD, HYDFLJ11310, Hyperplastic discs protein homolog, KIAA0896MGC57263, progestin induced protein, Progestin-induced protein, ubiquitin protein ligase E3 component n-recognin 5, ubiquitin-protein ligase
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: UBR5
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GSTSKEGEPNLDKKNTPVQSPVSLGEDLQWWPDKDGTKFICIGALYSELLAVSSKGELYQWKWSESEPYRNAQNPSLHHPRATFLGLTNEKI
• Quantity: 25 μL
• Research Discipline: DNA Repair
• Gene ID (Entrez): 51366
• Target Species: Human
• Isotype: IgG

For Research Use Only