UBE2K/E2-25K Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-54914

Product Code. 18258412

Description

UBE2K/E2-25K Polyclonal specifically detects UBE2K/E2-25K in Human samples. It is validated for Western Blot.

Specifications

• Antigen: UBE2K/E2-25K
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: E2(25K), E2-25K, EC 6.3.2.19, HIP-2, huntingtin interacting protein 2, Huntingtin-interacting protein 2, HYPG, ubiquitin carrier protein, ubiquitin-conjugating enzyme E2 K, Ubiquitin-conjugating enzyme E2(25K), Ubiquitin-conjugating enzyme E2-25 kDa, Ubiquitin-conjugating enzyme E2-25K, ubiquitin-conjugating enzyme E2K (UBC1 homolog, yeast), ubiquitin-protein ligase
• Host Species: Rabbit
• Molecular Weight of Antigen: 22 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: P61086
• Gene Symbols: UBE2K
• Immunogen: Synthetic peptides corresponding to UBE2K/E2-25K The peptide sequence was selected from the N terminal of UBE2K/E2-25K. Peptide sequence MANIAVQRIKREFKEVLKSEETSKNQIKVDLVDENFTELRGEIAGPPDTP.
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Gene ID (Entrez): 3093
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Goat, Rabbit, Zebrafish
• Form: Purified