missing translation for 'onlineSavingsMsg'
Learn More
Learn More
UbcH5b/UBE2D2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£362.00
Specifications
| Antigen | UbcH5b/UBE2D2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
UbcH5b/UBE2D2 Polyclonal specifically detects UbcH5b/UBE2D2 in Human samples. It is validated for Western Blot.Specifications
| UbcH5b/UBE2D2 | |
| Polyclonal | |
| Rabbit | |
| Cancer, Hypoxia | |
| E2(17)KB2, EC 6.3.2.19, PUBC1, UBC4/5, UBC4ubiquitin-conjugating enzyme E2D 2 (homologous to yeast UBC4/5), UBC5B, UBCH4, UbcH5B, Ubiquitin carrier protein D2, ubiquitin-conjugating enzyme E2 D2, Ubiquitin-conjugating enzyme E2(17)KB 2, Ubiquitin-conjugating enzyme E2-17 kDa 2, ubiquitin-conjugating enzyme E2D 2 (UBC4/5 homolog, yeast), Ubiquitin-protein ligase D2 | |
| UBE2D2 | |
| IgG | |
| 17 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| P62837 | |
| 7322 | |
| Synthetic peptides corresponding to UBE2D2(ubiquitin-conjugating enzyme E2D 2 (UBC4/5 homolog, yeast)) The peptide sequence was selected from the N terminal of UBE2D2. Peptide sequence ALKRIHKELNDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFF. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title