UbcH5b/UBE2D2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-55275

Product Code. 18282761

Description

UbcH5b/UBE2D2 Polyclonal specifically detects UbcH5b/UBE2D2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: UbcH5b/UBE2D2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: E2(17)KB2, EC 6.3.2.19, PUBC1, UBC4/5, UBC4ubiquitin-conjugating enzyme E2D 2 (homologous to yeast UBC4/5), UBC5B, UBCH4, UbcH5B, Ubiquitin carrier protein D2, ubiquitin-conjugating enzyme E2 D2, Ubiquitin-conjugating enzyme E2(17)KB 2, Ubiquitin-conjugating enzyme E2-17 kDa 2, ubiquitin-conjugating enzyme E2D 2 (UBC4/5 homolog, yeast), Ubiquitin-protein ligase D2
• Host Species: Rabbit
• Molecular Weight of Antigen: 17 kDa
• Quantity: 100 μL
• Research Discipline: Cancer, Hypoxia
• Gene ID (Entrez): 7322
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: P62837
• Gene Symbols: UBE2D2
• Immunogen: Synthetic peptides corresponding to UBE2D2(ubiquitin-conjugating enzyme E2D 2 (UBC4/5 homolog, yeast)) The peptide sequence was selected from the N terminal of UBE2D2. Peptide sequence ALKRIHKELNDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFF.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Goat: 79%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Goat, Rabbit, Zebrafish
• Isotype: IgG