missing translation for 'onlineSavingsMsg'
Learn More
Learn More
U2AF35 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£145.00 - £417.00
Specifications
| Antigen | U2AF35 |
|---|---|
| Dilution | Western Blot 1:500 - 1:2000, ELISA, Immunohistochemistry, Immunoprecipitation 0.5ug - 4ug antibody for 200ug - 400ug extracts of whole cells, Immunohistochemistry-Paraffin 1:100 - 1:200 |
| Applications | ELISA, Immunohistochemistry, Immunoprecipitation, Western Blot, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
30231568
|
Novus Biologicals
NBP3-35321-100ul |
100 μL |
£417.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
30228405
|
Novus Biologicals
NBP3-35321-20ul |
20 μL |
£145.00
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
U2AF35 Polyclonal antibody specifically detects U2AF35 in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Immunoprecipitation,Western Blot,Immunohistochemistry (Paraffin)Specifications
| U2AF35 | |
| ELISA, Immunohistochemistry, Immunoprecipitation, Western Blot, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Core ESC Like Genes, Stem Cell Markers | |
| PBS (pH 7.3), 50% glycerol | |
| 7307 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500 - 1:2000, ELISA, Immunohistochemistry, Immunoprecipitation 0.5ug - 4ug antibody for 200ug - 400ug extracts of whole cells, Immunohistochemistry-Paraffin 1:100 - 1:200 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| FP793, human U2 snRNP auxiliary factor small subunit10U2AF35DKFZp313J1712, RN, RNU2AF1,35-KD subunit, U2 auxiliary factor 35 kDa subunit, U2 small nuclear RNA auxiliary factor 1, U2 small nuclear RNA auxillary factor 1, U2 snRNP auxiliary factor small subunit | |
| A synthetic peptide corresponding to a sequence within amino acids 1-100 of human U2AF35 (NP_006749.1).,, Sequence:, MAEYLASIFGTEKDKVNCSFYFKIGACRHGDRCSRLHNKPTFSQTIALLNIYRNPQNSSQSADGLRCAVSDVEMQEHYDEFFEEVFTEMEEKYGEVEEMN | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title