U2AF35 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-35321-100ul

Product Code. 30231568

Description

U2AF35 Polyclonal antibody specifically detects U2AF35 in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Immunoprecipitation,Western Blot,Immunohistochemistry (Paraffin)

Specifications

• Antigen: U2AF35
• Classification: Polyclonal
• Dilution: Western Blot 1:500 - 1:2000, ELISA, Immunohistochemistry, Immunoprecipitation 0.5ug - 4ug antibody for 200ug - 400ug extracts of whole cells, Immunohistochemistry-Paraffin 1:100 - 1:200
• Gene Alias: FP793, human U2 snRNP auxiliary factor small subunit10U2AF35DKFZp313J1712, RN, RNU2AF1,35-KD subunit, U2 auxiliary factor 35 kDa subunit, U2 small nuclear RNA auxiliary factor 1, U2 small nuclear RNA auxillary factor 1, U2 snRNP auxiliary factor small subunit
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human U2AF35 (NP_006749.1).,, Sequence:, MAEYLASIFGTEKDKVNCSFYFKIGACRHGDRCSRLHNKPTFSQTIALLNIYRNPQNSSQSADGLRCAVSDVEMQEHYDEFFEEVFTEMEEKYGEVEEMN
• Quantity: 100 μL
• Research Discipline: Core ESC Like Genes, Stem Cell Markers
• Gene ID (Entrez): 7307
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: ELISA, Immunohistochemistry, Immunoprecipitation, Western Blot, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.3), 50% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Form: Purified