missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Tyrosine Hydroxylase Antibody (CL3049), Novus Biologicals™
Mouse Monoclonal Antibody
£232.00 - £451.00
Specifications
| Antigen | Tyrosine Hydroxylase |
|---|---|
| Clone | CL3049 |
| Dilution | Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Monoclonal |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18631696
|
Novus Biologicals
NBP2-46647-25ul |
25 μL |
£232.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18694805
|
Novus Biologicals
NBP2-46647 |
0.1 mL |
£451.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Tyrosine Hydroxylase Monoclonal antibody specifically detects Tyrosine Hydroxylase in Human, Mouse, Rat samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| Tyrosine Hydroxylase | |
| Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| Monoclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| P07101 | |
| 7054 | |
| IgG1 | |
| Protein A purified |
| CL3049 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Mouse | |
| Cancer, Lipid and Metabolism, Neurodegeneration, Neuronal Cell Markers, Neuroscience, Neurotransmission, Prostate Cancer | |
| PBS (pH 7.2), 40% Glycerol | |
| DYT14, DYT5b, EC 1.14.16, EC 1.14.16.2, TH, TYH dystonia 14, Tyrosine 3-hydroxylase, tyrosine 3-monooxygenase, tyrosine hydroxylase | |
| This Tyrosine Hydroxylase Antibody (CL3049) is made against a recombinant protein epitope signature tag (PrEST) antigen sequence corresponding to AA465-528 of human tyrosine hydroxylase (UniProtKB - P07101): SESFSDAKDKLRSYASRIQRPFSVKFDPYTLAIDVLDSPQAVRRSLEGVQDELDTLAHALSAIG | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title