missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Tyrosine Hydroxylase Antibody (CL3049), Novus Biologicals™
Mouse Monoclonal Antibody
Brand: Novus Biologicals NBP2-46647
This item is not returnable.
View return policy
Description
Tyrosine Hydroxylase Monoclonal antibody specifically detects Tyrosine Hydroxylase in Human, Mouse, Rat samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| Tyrosine Hydroxylase | |
| Monoclonal | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol | |
| DYT14, DYT5b, EC 1.14.16, EC 1.14.16.2, TH, TYH dystonia 14, Tyrosine 3-hydroxylase, tyrosine 3-monooxygenase, tyrosine hydroxylase | |
| This Tyrosine Hydroxylase Antibody (CL3049) is made against a recombinant protein epitope signature tag (PrEST) antigen sequence corresponding to AA465-528 of human tyrosine hydroxylase (UniProtKB - P07101): SESFSDAKDKLRSYASRIQRPFSVKFDPYTLAIDVLDSPQAVRRSLEGVQDELDTLAHALSAIG | |
| 0.1 mL | |
| Cancer, Lipid and Metabolism, Neurodegeneration, Neuronal Cell Markers, Neuroscience, Neurotransmission, Prostate Cancer | |
| 7054 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG1 |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| CL3049 | |
| Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| P07101 | |
| Mouse | |
| Protein A purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction