TUSC4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Product Code	Brand	Quantity
18411771	Novus Biologicals NBP1-82537-25ul	25 μL
18298696	Novus Biologicals NBP1-82537	0.1 mL

Description

TUSC4 Polyclonal specifically detects TUSC4 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: TUSC4
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Cell Cycle and Replication
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: G21 protein, Gene 21 protein, homologous to yeast nitrogen permease (candidate tumor suppressor), nitrogen permease regulator 2-like protein, nitrogen permease regulator-like 2 (S. cerevisiae), NPR2, NPR2L2810446G01Rik, NPRL2, Tumor suppressor candidate 4NPR2-like protein, TUSC4
• Gene Symbols: NPRL2
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Concentration: 0.4mg/mL
• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human
• Gene Accession No.: Q8WTW4
• Gene ID (Entrez): 10641
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: YSNVYCPTPKVQDLVDDKSLQEACLSYVTKQGHKRASLRDVFQLYCSLSPGTTVRDLIGRHPQQLQHVD
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only