missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TUSC4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-82537-25ul
This item is not returnable.
View return policy
Description
TUSC4 Polyclonal specifically detects TUSC4 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications
| TUSC4 | |
| Polyclonal | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| G21 protein, Gene 21 protein, homologous to yeast nitrogen permease (candidate tumor suppressor), nitrogen permease regulator 2-like protein, nitrogen permease regulator-like 2 (S. cerevisiae), NPR2, NPR2L2810446G01Rik, NPRL2, Tumor suppressor candidate 4NPR2-like protein, TUSC4 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| 0.4mg/mL | |
| Western Blot 0.4 ug/ml, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| Q8WTW4 | |
| NPRL2 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: YSNVYCPTPKVQDLVDDKSLQEACLSYVTKQGHKRASLRDVFQLYCSLSPGTTVRDLIGRHPQQLQHVD | |
| 25 μL | |
| Cell Cycle and Replication | |
| 10641 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction