missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TTC9C Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£362.00
Specifications
| Antigen | TTC9C |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
TTC9C Polyclonal specifically detects TTC9C in Human samples. It is validated for Western Blot.Specifications
| TTC9C | |
| Polyclonal | |
| Rabbit | |
| Q8N5M4 | |
| 283237 | |
| Synthetic peptides corresponding to TTC9C(tetratricopeptide repeat domain 9C) The peptide sequence was selected from the N terminal of TTC9C. Peptide sequence MEKRLQEAQLYKEEGNQRYREGKYRDAVSRYHRALLQLRGLDPSLPSPLP. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| MGC29649, tetratricopeptide repeat domain 9C, tetratricopeptide repeat protein 9C, TPR repeat protein 9C | |
| TTC9C | |
| IgG | |
| 20 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title