missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TTC8 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | TTC8 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
TTC8 Polyclonal specifically detects TTC8 in Human samples. It is validated for Western Blot.Specifications
| TTC8 | |
| Polyclonal | |
| Rabbit | |
| Cancer, Vision | |
| Bardet-Biedl syndrome 8 protein, BBS8Bardet-Biedl syndrome type 8, RP51, tetratricopeptide repeat domain 8, tetratricopeptide repeat protein 8, TPR repeat protein 8 | |
| TTC8 | |
| IgG | |
| 54 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q8TAM2-3 | |
| 123016 | |
| Synthetic peptides corresponding to TTC8(tetratricopeptide repeat domain 8) The peptide sequence was selected from the N terminal of TTC8. Peptide sequence ENAIAQVPRPGTSLKLPGTNQTGGPSQAVRPITQAGRPITGFLRPSTQSG. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title