TTC8 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Marca:  Novus Biologicals NBP1-55108

Código de producto. 18229344

Descripción

TTC8 Polyclonal specifically detects TTC8 in Human samples. It is validated for Western Blot.

Especificaciones

• Antigen: TTC8
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Bardet-Biedl syndrome 8 protein, BBS8Bardet-Biedl syndrome type 8, RP51, tetratricopeptide repeat domain 8, tetratricopeptide repeat protein 8, TPR repeat protein 8
• Host Species: Rabbit
• Molecular Weight of Antigen: 54 kDa
• Quantity: 100 μL
• Research Discipline: Cancer, Vision
• Gene ID (Entrez): 123016
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q8TAM2-3
• Gene Symbols: TTC8
• Immunogen: Synthetic peptides corresponding to TTC8(tetratricopeptide repeat domain 8) The peptide sequence was selected from the N terminal of TTC8. Peptide sequence ENAIAQVPRPGTSLKLPGTNQTGGPSQAVRPITQAGRPITGFLRPSTQSG.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.