missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TSPAN32/TSSC6 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£378.00
Specifications
| Antigen | TSPAN32/TSSC6 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
Description
TSPAN32/TSSC6 Polyclonal specifically detects TSPAN32/TSSC6 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| TSPAN32/TSSC6 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Q96QS1-2 | |
| 10077 | |
| Synthetic peptides corresponding to TSPAN32(tetraspanin 32) The peptide sequence was selected from the middle region of TSPAN32. Peptide sequence YEQAMKGTSHVRRQELAAIQDVFLCCGKKSPFSRLGSTEADLCQGEEAAR. | |
| Primary | |
| 31 kDa |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Human | |
| ART1, FLJ17158, FLJ97586, MGC22455, pan-hematopoietic expression, PHEMXPHMX, Protein Phemx, tetraspanin 32, tetraspanin-32, tspan-32, TSSC6pan-hematopoietic expression protein, tumor-suppressing STF cDNA 6, tumor-suppressing subchromosomal transferable fragment cDNA 6, tumor-suppressing subtransferable candidate 6 | |
| TSPAN32 | |
| IgG | |
| Protein A purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title