TSPAN32/TSSC6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-62646

Product Code. 18282453

Description

TSPAN32/TSSC6 Polyclonal specifically detects TSPAN32/TSSC6 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: TSPAN32/TSSC6
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: ART1, FLJ17158, FLJ97586, MGC22455, pan-hematopoietic expression, PHEMXPHMX, Protein Phemx, tetraspanin 32, tetraspanin-32, tspan-32, TSSC6pan-hematopoietic expression protein, tumor-suppressing STF cDNA 6, tumor-suppressing subchromosomal transferable fragment cDNA 6, tumor-suppressing subtransferable candidate 6
• Host Species: Rabbit
• Molecular Weight of Antigen: 31 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
• Gene Accession No.: Q96QS1-2
• Gene Symbols: TSPAN32
• Immunogen: Synthetic peptides corresponding to TSPAN32(tetraspanin 32) The peptide sequence was selected from the middle region of TSPAN32. Peptide sequence YEQAMKGTSHVRRQELAAIQDVFLCCGKKSPFSRLGSTEADLCQGEEAAR.
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Gene ID (Entrez): 10077
• Target Species: Human
• Form: Purified