missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Trypsin 2/PRSS2 Rabbit anti-Human, Mouse, Rat, Clone: 3D9O7, Novus Biologicals™
Rabbit Monoclonal Antibody
£158.00 - £386.00
Specifications
| Antigen | Trypsin 2/PRSS2 |
|---|---|
| Clone | 3D9O7 |
| Dilution | Western Blot 1:2000 - 1:6000, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Monoclonal |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18392056
|
Novus Biologicals
NBP3-15733-20UL |
20 μg |
£158.00
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18334137
|
Novus Biologicals
NBP3-15733-100UL |
100 μg |
£386.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Trypsin 2/PRSS2 Monoclonal antibody specifically detects Trypsin 2/PRSS2 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| Trypsin 2/PRSS2 | |
| Western Blot 1:2000 - 1:6000, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin | |
| Monoclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| Anionic trypsinogen, EC 3.4.21, EC 3.4.21.4, MGC111183, MGC120174, MGC120175, protease serine 2 preproprotein, protease, serine, 2 (trypsin 2), protease, serine, 2, preproprotein, Serine protease 2, TRY2TRY8, TRYP2, trypsin 2, Trypsin II, trypsin-2, trypsinogen 2 | |
| A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Trypsin 2/PRSS2 (P07478). MNLLLILTFVAAAVAAPFDDDDKIVGGYICEENSVPYQVSLNSGYHFCGGSLISEQWVVSAGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPKYN | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
| 3D9O7 | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Cell Biology | |
| PBS, 0.05% BSA, 50% glycerol, pH7.3 | |
| 5645 | |
| IgG | |
| Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title