missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Trypsin 2/PRSS2 Rabbit anti-Human, Mouse, Rat, Clone: 3D9O7, Novus Biologicals™
Rabbit Monoclonal Antibody
Brand: Novus Biologicals NBP3-15733-20UL
This item is not returnable.
View return policy
Description
Trypsin 2/PRSS2 Monoclonal antibody specifically detects Trypsin 2/PRSS2 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| Trypsin 2/PRSS2 | |
| Monoclonal | |
| Unconjugated | |
| PBS, 0.05% BSA, 50% glycerol, pH7.3 | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| 3D9O7 | |
| Western Blot 1:2000 - 1:6000, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin | |
| Anionic trypsinogen, EC 3.4.21, EC 3.4.21.4, MGC111183, MGC120174, MGC120175, protease serine 2 preproprotein, protease, serine, 2 (trypsin 2), protease, serine, 2, preproprotein, Serine protease 2, TRY2TRY8, TRYP2, trypsin 2, Trypsin II, trypsin-2, trypsinogen 2 | |
| A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Trypsin 2/PRSS2 (P07478). MNLLLILTFVAAAVAAPFDDDDKIVGGYICEENSVPYQVSLNSGYHFCGGSLISEQWVVSAGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPKYN | |
| 20 μg | |
| Cell Biology | |
| 5645 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction