missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Trypsin 2/PRSS2 Rabbit anti-Human, Mouse, Rat, Clone: 3D9O7, Novus Biologicals™
Shop All Bio Techne ProductsDescription
Trypsin 2/PRSS2 Monoclonal antibody specifically detects Trypsin 2/PRSS2 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
Specifications
| Antigen | Trypsin 2/PRSS2 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Monoclonal |
| Clone | 3D9O7 |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1:2000 - 1:6000, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin |
| Formulation | PBS, 0.05% BSA, 50% glycerol, pH7.3 |
| Gene Alias | Anionic trypsinogen, EC 3.4.21, EC 3.4.21.4, MGC111183, MGC120174, MGC120175, protease serine 2 preproprotein, protease, serine, 2 (trypsin 2), protease, serine, 2, preproprotein, Serine protease 2, TRY2TRY8, TRYP2, trypsin 2, Trypsin II, trypsin-2, trypsinogen 2 |
| Host Species | Rabbit |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Trypsin 2/PRSS2 (P07478). MNLLLILTFVAAAVAAPFDDDDKIVGGYICEENSVPYQVSLNSGYHFCGGSLISEQWVVSAGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPKYN |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?