missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TRUSS Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£328.00 - £513.00
Specifications
| Antigen | TRUSS |
|---|---|
| Dilution | Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18161519
|
Novus Biologicals
NBP2-47593 |
0.1 mL |
£513.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18651846
|
Novus Biologicals
NBP2-47593-25ul |
25 μL |
£328.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
TRUSS Polyclonal specifically detects TRUSS in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| TRUSS | |
| Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 26133 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: LIWRKHSASALVLHGHNQNCDCSPDITLKIQFLRLLQSFSDHHENKYLLLNNQELNELSAISLKANIPEVEAVLNTDRSLVCDGK | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| C20orf188, dJ756N5.2, DKFZp586C1223, DKFZP727M231, Protein TAP1, Protein TRUSS, short transient receptor potential channel 4 associated protein, short transient receptor potential channel 4-associated protein, TNF-receptor ubiquitous scaffolding/signaling protein, transient receptor potential cation channel, subfamily C, member 4 associatedprotein, Trp4-associated protein, Trpc4-associated protein, TRRP4APchromosome 20 open reading frame 188, TRUSS, tumor necrosis factor receptor-associated ubiquitous scaffolding and signalingprotein | |
| TRPC4AP | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title