TRUSS Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-47593-25ul

Product Code. 18651846

Description

TRUSS Polyclonal specifically detects TRUSS in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: TRUSS
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: C20orf188, dJ756N5.2, DKFZp586C1223, DKFZP727M231, Protein TAP1, Protein TRUSS, short transient receptor potential channel 4 associated protein, short transient receptor potential channel 4-associated protein, TNF-receptor ubiquitous scaffolding/signaling protein, transient receptor potential cation channel, subfamily C, member 4 associatedprotein, Trp4-associated protein, Trpc4-associated protein, TRRP4APchromosome 20 open reading frame 188, TRUSS, tumor necrosis factor receptor-associated ubiquitous scaffolding and signalingprotein
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 26133
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: TRPC4AP
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: LIWRKHSASALVLHGHNQNCDCSPDITLKIQFLRLLQSFSDHHENKYLLLNNQELNELSAISLKANIPEVEAVLNTDRSLVCDGK
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

For Research Use Only