missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Tropomyosin-1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | Tropomyosin-1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
Tropomyosin-1 Polyclonal specifically detects Tropomyosin-1 in Human, Rat samples. It is validated for Western Blot.Specifications
| Tropomyosin-1 | |
| Polyclonal | |
| Rabbit | |
| Cytoskeleton Markers | |
| alpha tropomyosin, alpha-tropomyosin, C15orf13, cardiomyopathy, hypertrophic 3, chromosome 15 open reading frame 13, CMD1Y, CMH3, HTM-alpha, sarcomeric tropomyosin kappa, TMSA, tropomyosin 1 (alpha), tropomyosin 1 (alpha) isoform 1, tropomyosin 1 (alpha) isoform 2, tropomyosin 1 (alpha) isoform 3, tropomyosin 1 (alpha) isoform 4, tropomyosin 1 (alpha) isoform 5, tropomyosin 1 (alpha) isoform 6, tropomyosin 1 (alpha) isoform 7, tropomyosin alpha-1 chain, Tropomyosin-1 | |
| TPM1 | |
| IgG | |
| 28 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q7Z6L8 | |
| 7168 | |
| Synthetic peptides corresponding to TPM1(tropomyosin 1 (alpha)) The peptide sequence was selected from the middle region of TPM1. Peptide sequence LKEAETRAEFAERSVTKLEKSIDDLEDQLYQQLEQNRRLTNELKLALNED. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title