Tropomyosin-1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-52887

Product Code. 18274581

Description

Tropomyosin-1 Polyclonal specifically detects Tropomyosin-1 in Human, Rat samples. It is validated for Western Blot.

Specifications

• Antigen: Tropomyosin-1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: alpha tropomyosin, alpha-tropomyosin, C15orf13, cardiomyopathy, hypertrophic 3, chromosome 15 open reading frame 13, CMD1Y, CMH3, HTM-alpha, sarcomeric tropomyosin kappa, TMSA, tropomyosin 1 (alpha), tropomyosin 1 (alpha) isoform 1, tropomyosin 1 (alpha) isoform 2, tropomyosin 1 (alpha) isoform 3, tropomyosin 1 (alpha) isoform 4, tropomyosin 1 (alpha) isoform 5, tropomyosin 1 (alpha) isoform 6, tropomyosin 1 (alpha) isoform 7, tropomyosin alpha-1 chain, Tropomyosin-1
• Host Species: Rabbit
• Molecular Weight of Antigen: 28 kDa
• Quantity: 100 μL
• Research Discipline: Cytoskeleton Markers
• Gene ID (Entrez): 7168
• Target Species: Human, Rat, Rat
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q7Z6L8
• Gene Symbols: TPM1
• Immunogen: Synthetic peptides corresponding to TPM1(tropomyosin 1 (alpha)) The peptide sequence was selected from the middle region of TPM1. Peptide sequence LKEAETRAEFAERSVTKLEKSIDDLEDQLYQQLEQNRRLTNELKLALNED.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.