missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TRMT1L Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | TRMT1L |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
TRMT1L Polyclonal specifically detects TRMT1L in Human samples. It is validated for Western Blot.Specifications
| TRMT1L | |
| Polyclonal | |
| Rabbit | |
| C1orf25MST070, chromosome 1 open reading frame 25, MGC25112, MGC57134, TRM1 tRNA methyltransferase 1-like, TRM1LbG120K12.3, TRM1-like protein | |
| TRMT1L | |
| IgG | |
| 61 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| 81627 | |
| Synthetic peptide directed towards the N terminal of human C1ORF25. Peptide sequence QAPALSPSLASAPEEAKSKRHISIQRQLADLENLAFVTDGNFDSASSLNS. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title