TRMT1L Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-79968

Product Code. 18250156

Description

TRMT1L Polyclonal specifically detects TRMT1L in Human samples. It is validated for Western Blot.

Specifications

• Antigen: TRMT1L
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Symbols: TRMT1L
• Immunogen: Synthetic peptide directed towards the N terminal of human C1ORF25. Peptide sequence QAPALSPSLASAPEEAKSKRHISIQRQLADLENLAFVTDGNFDSASSLNS.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 81627
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: C1orf25MST070, chromosome 1 open reading frame 25, MGC25112, MGC57134, TRM1 tRNA methyltransferase 1-like, TRM1LbG120K12.3, TRM1-like protein
• Host Species: Rabbit
• Molecular Weight of Antigen: 61 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Canine: 86%; Porcine: 86%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine
• Isotype: IgG