missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TRMT1L Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-79968
This item is not returnable.
View return policy
Description
TRMT1L Polyclonal specifically detects TRMT1L in Human samples. It is validated for Western Blot.
Specifications
| TRMT1L | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| TRMT1L | |
| Synthetic peptide directed towards the N terminal of human C1ORF25. Peptide sequence QAPALSPSLASAPEEAKSKRHISIQRQLADLENLAFVTDGNFDSASSLNS. | |
| Affinity purified | |
| RUO | |
| 81627 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| C1orf25MST070, chromosome 1 open reading frame 25, MGC25112, MGC57134, TRM1 tRNA methyltransferase 1-like, TRM1LbG120K12.3, TRM1-like protein | |
| Rabbit | |
| 61 kDa | |
| 100 μL | |
| Primary | |
| Canine: 86%; Porcine: 86%. | |
| Human, Mouse, Rat, Pig, Bovine, Canine, Equine | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction