missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TRM11 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£362.00
Specifications
| Antigen | TRM11 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
TRM11 Polyclonal specifically detects TRM11 in Human samples. It is validated for Western Blot.Specifications
| TRM11 | |
| Polyclonal | |
| Rabbit | |
| Q7Z4G4 | |
| 60487 | |
| Synthetic peptides corresponding to TRMT11(tRNA methyltransferase 11 homolog (S. cerevisiae)) The peptide sequence was selected from the N terminal of TRMT11. Peptide sequence IKIHTFNKTLTQEEKIKRIDALEFLPFEGKVNLKKPQHVFSVLEDYGLDP. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| C6orf75, chromosome 6 open reading frame 75, dJ187J11.2, EC 2.1.1, EC 2.1.1.-, EC 2.1.1.113, MDS024, TRM11, TRMT11-1, tRNA guanosine-2'-O-methyltransferase TRM11 homolog, tRNA methyltransferase 11 homolog (S. cerevisiae) | |
| TRMT11 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title