TRM11 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-52998

Product Code. 18289752

Description

TRM11 Polyclonal specifically detects TRM11 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: TRM11
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: C6orf75, chromosome 6 open reading frame 75, dJ187J11.2, EC 2.1.1, EC 2.1.1.-, EC 2.1.1.113, MDS024, TRM11, TRMT11-1, tRNA guanosine-2'-O-methyltransferase TRM11 homolog, tRNA methyltransferase 11 homolog (S. cerevisiae)
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 60487
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q7Z4G4
• Gene Symbols: TRMT11
• Immunogen: Synthetic peptides corresponding to TRMT11(tRNA methyltransferase 11 homolog (S. cerevisiae)) The peptide sequence was selected from the N terminal of TRMT11. Peptide sequence IKIHTFNKTLTQEEKIKRIDALEFLPFEGKVNLKKPQHVFSVLEDYGLDP.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Canine: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Pig: 92%; Chicken: 84%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG