Tripeptidyl-Peptidase I/TPP1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-48820

Product Code. 18666685

Description

Tripeptidyl-Peptidase I/TPP1 Polyclonal antibody specifically detects Tripeptidyl-Peptidase I/TPP1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: Tripeptidyl-Peptidase I/TPP1
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Alias: Cell growth-inhibiting gene 1 protein, ceroid-lipofuscinosis, neuronal 2, late infantile (Jansky-Bielschowsky disease), CLN2EC 3.4.14.9, growth-inhibiting protein 1, LPIC, lysosomal pepstatin insensitive protease, Lysosomal pepstatin-insensitive protease, MGC21297, TPP-1, TPP-I, Tripeptidyl aminopeptidase, tripeptidyl peptidase I, tripeptidyl-peptidase 1, Tripeptidyl-peptidase I
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: SSLRQRPEPQVTGTVGLHLGVTPSVIRKRYNLTSQDVGSGTSNNSQACAQFLEQYFHDSDLAQFMRLFGGNFAHQASVARVV
• Quantity: 0.1 mL
• Research Discipline: Neuroscience
• Gene ID (Entrez): 1200
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol
• Host Species: Rabbit
• Purification Method: Immunogen affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified