TRIM8 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Brand:  Novus Biologicals NBP1-89776-25ul

Product Code. 18475481

Description

TRIM8 Polyclonal specifically detects TRIM8 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated.

Specifications

• Antigen: GERP
• Classification: Polyclonal
• Dilution: Western Blot, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200, Knockdown Validated
• Gene Accession No.: Q9BZR9
• Gene Symbols: TRIM8
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:QDIEDQLYKLESDKRLVEEKVNQLKEEVRLQYEKLHQLLDEDLRQTVEVLDKAQAKFCSENAAQALHLGERMQEAKKLLGS
• Quantity: 25 μL
• Research Discipline: Zinc Finger
• Gene ID (Entrez): 81603
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: EC 6.3.2.-, GERPRING finger protein 27glioblastoma expressed ring finger protein, Glioblastoma-expressed RING finger protein, RNF27probable E3 ubiquitin-protein ligase TRIM8, tripartite motif containing 8, tripartite motif protein TRIM8, tripartite motif-containing 8, Tripartite motif-containing protein 8
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only