missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TRIAD3 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
£161.00 - £359.00
Specifications
| Antigen | TRIAD3 |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18378456
|
Novus Biologicals
NBP3-10075-25UL |
25 μg |
£161.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18343237
|
Novus Biologicals
NBP3-10075-100UL |
100 μg |
£359.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
TRIAD3 Polyclonal specifically detects TRIAD3 in Human samples. It is validated for Western Blot.Specifications
| TRIAD3 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Human | |
| EC 6.3.2.-, ring finger protein 216Ubiquitin-conjugating enzyme 7-interacting protein 1, Triad domain-containing protein 3, TRIAD3Zinc finger protein inhibiting NF-kappa-B, U7I1, UBCE7IP1ubiquitin conjugating enzyme 7 interacting protein 1, ZINE3 ubiquitin-protein ligase RNF216 | |
| The immunogen is a synthetic peptide directed towards the middle terminal region of human TRIAD3 (NP_996994.1). Peptide sequence TEDDEKLIEEIQKEAEEEQKRKNGENTFKRIGPPLEKPVEKVQRVEALPR | |
| Affinity purified |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS buffer, 2% sucrose | |
| 54476 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts