TRIAD3 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-10075-100UL

Product Code. 18343237

Description

TRIAD3 Polyclonal specifically detects TRIAD3 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: TRIAD3
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: EC 6.3.2.-, ring finger protein 216Ubiquitin-conjugating enzyme 7-interacting protein 1, Triad domain-containing protein 3, TRIAD3Zinc finger protein inhibiting NF-kappa-B, U7I1, UBCE7IP1ubiquitin conjugating enzyme 7 interacting protein 1, ZINE3 ubiquitin-protein ligase RNF216
• Immunogen: The immunogen is a synthetic peptide directed towards the middle terminal region of human TRIAD3 (NP_996994.1). Peptide sequence TEDDEKLIEEIQKEAEEEQKRKNGENTFKRIGPPLEKPVEKVQRVEALPR
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS buffer, 2% sucrose
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 54476
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.