missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TRAPPC2L Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | TRAPPC2L |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
TRAPPC2L Polyclonal specifically detects TRAPPC2L in Human samples. It is validated for Western Blot.Specifications
| TRAPPC2L | |
| Polyclonal | |
| Rabbit | |
| MGC111156, trafficking protein particle complex 2-like, trafficking protein particle complex subunit 2-like protein | |
| TRAPPC2L | |
| IgG | |
| This product is specific to Subunit or Isoform: 2-like protein. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| 51693 | |
| Synthetic peptides corresponding to TRAPPC2L(trafficking protein particle complex 2-like) The peptide sequence was selected from the N terminal of TRAPPC2L. Peptide sequence MAVCIAVIAKENYPLYIRSTPTENELKFHYMVHTSLDVVDEKISAMGKAL. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title