missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Transglutaminase 5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | Transglutaminase 5 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
Transglutaminase 5 Polyclonal specifically detects Transglutaminase 5 in Human samples. It is validated for Western Blot.Specifications
| Transglutaminase 5 | |
| Polyclonal | |
| Rabbit | |
| O43548 | |
| 9333 | |
| Synthetic peptides corresponding to TGM5(transglutaminase 5) The peptide sequence was selected from the C terminal of TGM5. Peptide sequence VLKPQHQASIILETVPFKSGQRQIQANMRSNKFKDIKGYRNVYVDFAL. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| EC 2.3.2.13, protein-glutamine gamma-glutamyltransferase 5, TG(X), TGase X, TGase-5, TGASE5, TGASEX, TGM6, TGMX, TGXMGC141907, transglutaminase 5, transglutaminase V, Transglutaminase X, transglutaminase-5 | |
| TGM5 | |
| IgG | |
| 81 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title