Transglutaminase 5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-54329

Product Code. 18252405

Description

Transglutaminase 5 Polyclonal specifically detects Transglutaminase 5 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Transglutaminase 5
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: EC 2.3.2.13, protein-glutamine gamma-glutamyltransferase 5, TG(X), TGase X, TGase-5, TGASE5, TGASEX, TGM6, TGMX, TGXMGC141907, transglutaminase 5, transglutaminase V, Transglutaminase X, transglutaminase-5
• Host Species: Rabbit
• Molecular Weight of Antigen: 81 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: O43548
• Gene Symbols: TGM5
• Immunogen: Synthetic peptides corresponding to TGM5(transglutaminase 5) The peptide sequence was selected from the C terminal of TGM5. Peptide sequence VLKPQHQASIILETVPFKSGQRQIQANMRSNKFKDIKGYRNVYVDFAL.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 9333
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG