missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TPD52L3/D55 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | TPD52L3/D55 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Beschreibung
TPD52L3/D55 Polyclonal specifically detects TPD52L3/D55 in Human samples. It is validated for Western Blot.Spezifikation
| TPD52L3/D55 | |
| Polyclonal | |
| Rabbit | |
| Protein Kinase | |
| hD55, MGC26757, NYDSP25, NYD-SP25, protein kinase NYD-SP25, Testis development protein NYD-SP25, tumor protein D52-like 3MGC45374, tumor protein D55 | |
| TPD52L3 | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q96J77-2 | |
| 89882 | |
| Synthetic peptides corresponding to TPD52L3(tumor protein D52-like 3) The peptide sequence was selected from the middle region of TPD52L3. Peptide sequence GLRQNLSKSWLDVQVSNTYVKQKTSAALSTMGTLICRKLGGVKKSATLRS. | |
| Primary |
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts