TPD52L3/D55 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-56498

Product Code. 18291751

Description

TPD52L3/D55 Polyclonal specifically detects TPD52L3/D55 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: TPD52L3/D55
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: hD55, MGC26757, NYDSP25, NYD-SP25, protein kinase NYD-SP25, Testis development protein NYD-SP25, tumor protein D52-like 3MGC45374, tumor protein D55
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%;.
• Target Species: Human, Canine, Equine, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q96J77-2
• Gene Symbols: TPD52L3
• Immunogen: Synthetic peptides corresponding to TPD52L3(tumor protein D52-like 3) The peptide sequence was selected from the middle region of TPD52L3. Peptide sequence GLRQNLSKSWLDVQVSNTYVKQKTSAALSTMGTLICRKLGGVKKSATLRS.
• Quantity: 100 μL
• Research Discipline: Protein Kinase
• Gene ID (Entrez): 89882
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.