missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TNFAIP1 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
£149.00 - £366.00
Specifications
| Antigen | TNFAIP1 |
|---|---|
| Dilution | Western Blot 1:500 - 1:2000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18647812
|
Novus Biologicals
NBP2-94181-0.02ml |
0.02 mL |
£149.00
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18608751
|
Novus Biologicals
NBP2-94181-0.1ml |
0.1 mL |
£366.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
TNFAIP1 Polyclonal antibody specifically detects TNFAIP1 in Human samples. It is validated for Western BlotSpecifications
| TNFAIP1 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Adaptive Immunity, Asthma, Autophagy, Cancer, Cytokine Research, Diabetes Research, Immune System Diseases, Immunology, Innate Immunity | |
| PBS (pH 7.3), 50% glycerol | |
| 7126 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500 - 1:2000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| B12, B61, BACURD2, BTB/POZ domain-containing adapter for CUL3-mediated RhoA degradation protein 2, BTB/POZ domain-containing protein TNFAIP1, EDP1, hBACURD2, MGC2317, Protein B12, tumor necrosis factor, alpha-induced protein 1 (endothelial), Tumor necrosis factor, alpha-induced protein 1, endothelial | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 90-160 of human TNFAIP1 (NP_066960.1). DTITLPQNRQEIKELMAEAKYYLIQGLVNMCQSALQDKKDSYQPVCNIPIITSLKEEERLIESSTKPVVKL | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title