missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
TNFAIP1 Polyclonal antibody specifically detects TNFAIP1 in Human samples. It is validated for Western Blot
Specifications
Specifications
| Antigen | TNFAIP1 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1:500 - 1:2000 |
| Formulation | PBS (pH 7.3), 50% glycerol |
| Gene Alias | B12, B61, BACURD2, BTB/POZ domain-containing adapter for CUL3-mediated RhoA degradation protein 2, BTB/POZ domain-containing protein TNFAIP1, EDP1, hBACURD2, MGC2317, Protein B12, tumor necrosis factor, alpha-induced protein 1 (endothelial), Tumor necrosis factor, alpha-induced protein 1, endothelial |
| Host Species | Rabbit |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 90-160 of human TNFAIP1 (NP_066960.1). DTITLPQNRQEIKELMAEAKYYLIQGLVNMCQSALQDKKDSYQPVCNIPIITSLKEEERLIESSTKPVVKL |
| Purification Method | Affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?