TNFAIP1 Antibody - Azide and BSA Free, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-94181-0.02ml

Product Code. 18647812

Description

TNFAIP1 Polyclonal antibody specifically detects TNFAIP1 in Human samples. It is validated for Western Blot

Specifications

• Antigen: TNFAIP1
• Classification: Polyclonal
• Dilution: Western Blot 1:500 - 1:2000
• Gene Alias: B12, B61, BACURD2, BTB/POZ domain-containing adapter for CUL3-mediated RhoA degradation protein 2, BTB/POZ domain-containing protein TNFAIP1, EDP1, hBACURD2, MGC2317, Protein B12, tumor necrosis factor, alpha-induced protein 1 (endothelial), Tumor necrosis factor, alpha-induced protein 1, endothelial
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 90-160 of human TNFAIP1 (NP_066960.1). DTITLPQNRQEIKELMAEAKYYLIQGLVNMCQSALQDKKDSYQPVCNIPIITSLKEEERLIESSTKPVVKL
• Quantity: 0.02 mL
• Research Discipline: Adaptive Immunity, Asthma, Autophagy, Cancer, Cytokine Research, Diabetes Research, Immune System Diseases, Immunology, Innate Immunity
• Gene ID (Entrez): 7126
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.3), 50% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified